XP_006680681.1 has 470 amino acids
Query: Mbeg1-like [M=224] Accession: PF11187.12 Description: Mbeg1-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-09 22.8 0.0 2e-07 16.9 0.0 2.4 2 XP_006680681.1 Domain annotation for each sequence (and alignments): >> XP_006680681.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.1 0.0 0.0032 0.0032 36 57 .. 247 267 .. 232 276 .. 0.84 2 ! 16.9 0.0 2e-07 2e-07 70 108 .. 306 344 .. 298 366 .. 0.79 Alignments for each domain: == domain 1 score: 3.1 bits; conditional E-value: 0.0032 Mbeg1-like 36 kdtlvvafRGtddtligWkedf 57 +t++v++RGt ++ + W++++ XP_006680681.1 247 LKTIIVSYRGTMGS-VDWRQNL 267 5799*******998.6899887 PP == domain 2 score: 16.9 bits; conditional E-value: 2e-07 Mbeg1-like 70 sAakYlkkilektegkiylaGhSkGgnlAvyaaanaedd 108 A l i + e ki ++GhSkGg lA+++a+++ + XP_006680681.1 306 VARALLMAISLHPEYKIHITGHSKGGTLATLTAVDLYMT 344 5677788888889999*****************985544 PP
Or compare XP_006680681.1 to CDD or PaperBLAST