VIMSS5775683 has 256 amino acids
Query: DUF3011 [M=197]
Accession: PF11218.12
Description: Protein of unknown function (DUF3011)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-22 66.7 2.2 2.2e-22 66.1 2.2 1.2 1 VIMSS5775683
Domain annotation for each sequence (and alignments):
>> VIMSS5775683
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.1 2.2 2.2e-22 2.2e-22 132 197 .] 118 183 .. 98 191 .. 0.86
Alignments for each domain:
== domain 1 score: 66.1 bits; conditional E-value: 2.2e-22
DUF3011 132 dgsGfpdsartltceskdrrrrscGvsverevkllrqlstsaceedrsWGwdrdrvWvddGcraef 197
++G + +r +tces d+++ sc + + +v+++rqls ++cee+++WG +r++vWv++Gcra f
VIMSS5775683 118 AAAGDAALPREVTCESTDQQQVSCDLNTRGNVEIVRQLSRTRCEEGKNWGLSRHSVWVNGGCRAVF 183
567777888999999999999999999999999999999999999999999999999999999976 PP
Or compare VIMSS5775683 to CDD or PaperBLAST