PaperBLAST – Find papers about a protein or its homologs

 

Align NP_010800.3 to PF11326 (DUF3128)

NP_010800.3 has 187 amino acids

Query:       DUF3128  [M=80]
Accession:   PF11326.12
Description: Protein of unknown function (DUF3128)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.8e-30   90.9   1.9    4.9e-30   90.1   1.9    1.4  1  NP_010800.3  


Domain annotation for each sequence (and alignments):
>> NP_010800.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   90.1   1.9   4.9e-30   4.9e-30       1      80 []     104     181 ..     104     181 .. 0.98

  Alignments for each domain:
  == domain 1  score: 90.1 bits;  conditional E-value: 4.9e-30
      DUF3128   1 tmscreafdellsCyslggqfknyYryGelksCsekwedfkfClrlkekkeeeaqealrereeekkakrkkssedvWelR 80 
                  tmscreafd+l+sCys+ggqf++yYryG+++sC+++ ++fkfC+ +  +++ ++qe+++++ +++ka + ++s  +W++R
  NP_010800.3 104 TMSCREAFDQLTSCYSIGGQFRSYYRYGDFTSCDKQVSKFKFCIIHG-NDPVKVQEWYKDQVSNNKALE-NTSGVIWQER 181
                  69********************************************9.*****************9997.********99 PP



Or compare NP_010800.3 to CDD or PaperBLAST