Q3U595 has 105 amino acids
Query: DUF3128 [M=80]
Accession: PF11326.12
Description: Protein of unknown function (DUF3128)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-20 59.2 3.4 2.4e-20 59.0 3.4 1.0 1 Q3U595
Domain annotation for each sequence (and alignments):
>> Q3U595
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.0 3.4 2.4e-20 2.4e-20 2 80 .] 11 88 .. 10 88 .. 0.96
Alignments for each domain:
== domain 1 score: 59.0 bits; conditional E-value: 2.4e-20
DUF3128 2 mscreafdellsCyslggqfknyYryGelksCsekwedfkfClrlkekkeeeaqealrereeekkakrkkssedvWelR 80
++c+ + e+ C s+g+ +++yY++G+ ++C ++ +d+ +C +++e++++eaq+ l e+e+ + + ++++ vW lR
Q3U595 11 RPCEVYRAEWELCRSVGHVLHHYYVHGKRPDCRQWLRDLTNCREWEESRSAEAQRSLCESEQVRVQAA-QKHTLVWALR 88
6899************************************************************9986.9999***998 PP
Or compare Q3U595 to CDD or PaperBLAST