VIMSS14657 has 271 amino acids
Query: DUF2877 [M=109]
Accession: PF11392.12
Description: Protein of unknown function (DUF2877)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-33 100.7 0.0 5.5e-33 100.1 0.0 1.3 1 VIMSS14657
Domain annotation for each sequence (and alignments):
>> VIMSS14657
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 100.1 0.0 5.5e-33 5.5e-33 1 108 [. 158 263 .. 158 264 .. 0.97
Alignments for each domain:
== domain 1 score: 100.1 bits; conditional E-value: 5.5e-33
DUF2877 1 lvGlGpGlTPsgDDflvGllaalallgakaakseaelleevaaaekkttdvSaalLraAlegevsesllallkalssedeeelakaieellaiGhtSGa 99
++G GpGlTPs+DD+l+G+l+a +++ga +a+s + +++ + + tt+vS ++Lr+A++g+++++ll++++als +++ a ai++lla+GhtSGa
VIMSS14657 158 WLGKGPGLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFASPLLHFVHALSCPKRT--AVAIDSLLALGHTSGA 254
68*************************************999***********************************8877..99************** PP
DUF2877 100 dlllGlllg 108
d+llG++lg
VIMSS14657 255 DTLLGFWLG 263
******997 PP
Or compare VIMSS14657 to CDD or PaperBLAST