SwissProt::C0KJQ4 has 123 amino acids
Query: Anti-LPS-SCYG [M=100]
Accession: PF11630.12
Description: Anti-lipopolysaccharide factor/Scygonadin
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-44 136.9 0.0 1.4e-44 136.7 0.0 1.0 1 SwissProt::C0KJQ4
Domain annotation for each sequence (and alignments):
>> SwissProt::C0KJQ4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 136.7 0.0 1.4e-44 1.4e-44 1 100 [] 24 122 .. 24 122 .. 0.98
Alignments for each domain:
== domain 1 score: 136.7 bits; conditional E-value: 1.4e-44
Anti-LPS-SCYG 1 ceaqaleklvaaiveklvelwrngevellgheCkvevkPkikkfelyykgkmwCpgWttikGesrtrsrsgvvekavrdFvqkAleaklite 92
ceaq +e+lv++i+ kl++lw+n++v+++gh C ++++Pki++f+ly++gk+wCpgW++++G+srt+srsg+ ++a++dFv+kAl+++l+t+
SwissProt::C0KJQ4 24 CEAQ-YEALVTSILGKLTGLWHNDSVDFMGHICYFRRRPKIRRFKLYHEGKFWCPGWAPFEGRSRTKSRSGSSREATKDFVRKALQNGLVTQ 114
8888.9************************************************************************************** PP
Anti-LPS-SCYG 93 eeakawlk 100
++a+ wl+
SwissProt::C0KJQ4 115 QDASLWLN 122
******96 PP
Or compare SwissProt::C0KJQ4 to CDD or PaperBLAST