VIMSS3627886 has 275 amino acids
Query: DUF3298 [M=83]
Accession: PF11738.12
Description: Protein of unknown function (DUF3298)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.9e-20 58.6 0.8 1.6e-19 56.9 0.0 2.1 2 VIMSS3627886
Domain annotation for each sequence (and alignments):
>> VIMSS3627886
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -0.7 0.3 0.16 0.16 24 30 .. 73 78 .. 42 110 .. 0.45
2 ! 56.9 0.0 1.6e-19 1.6e-19 1 83 [] 169 247 .. 169 247 .. 0.94
Alignments for each domain:
== domain 1 score: -0.7 bits; conditional E-value: 0.16
DUF3298 24 kqaeeqe 30
++ +++e
VIMSS3627886 73 AD-KKTE 78
11.1111 PP
== domain 2 score: 56.9 bits; conditional E-value: 1.6e-19
DUF3298 1 kDlFkpgsdylealselikkqlkkqaeeqeleeyeeleeefdaddisaydnFyltddglvfyfnpYeiaPyaaGaieftiPys 83
+Dl++p+ +++al++l+ +++k++ +++l++ ++ e +a+ ++ ++nF l d+gl++ + +Yei+Py++G ++++iPy+
VIMSS3627886 169 EDLLRPE--KKAALEKLAHEAFKAWVTDSKLANSVSEYE--QAWPFKLTENFLLGDQGLILQYGEYEIGPYVVGLPRLVIPYD 247
69*****..*****************9888777777777..9****************************************7 PP
Or compare VIMSS3627886 to CDD or PaperBLAST