WP_000958103.1 has 313 amino acids
Query: DUF3298 [M=83]
Accession: PF11738.12
Description: Protein of unknown function (DUF3298)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-19 57.0 0.6 5.5e-19 55.3 0.0 2.1 2 WP_000958103.1
Domain annotation for each sequence (and alignments):
>> WP_000958103.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -1.2 0.2 0.23 0.23 25 27 .. 112 114 .. 81 148 .. 0.45
2 ! 55.3 0.0 5.5e-19 5.5e-19 1 82 [. 207 284 .. 207 285 .. 0.95
Alignments for each domain:
== domain 1 score: -1.2 bits; conditional E-value: 0.23
DUF3298 25 qae 27
+++
WP_000958103.1 112 DKK 114
111 PP
== domain 2 score: 55.3 bits; conditional E-value: 5.5e-19
DUF3298 1 kDlFkpgsdylealselikkqlkkqaeeqeleeyeeleeefdaddisaydnFyltddglvfyfnpYeiaPyaaGaieftiPy 82
+Dl++p+ +++al++l+ +++k++ +++l++ ++ e +a+ ++ ++nF l d+gl++ + +Yei+Py++G ++++iPy
WP_000958103.1 207 EDLLRPE--KKAALEKLAHEAFKAWVTDSKLANSVSEYE--QAWPFKLTENFLLGDQGLILQYGEYEIGPYVVGLPRLVIPY 284
69*****..*****************9888777777777..9***************************************9 PP
Or compare WP_000958103.1 to CDD or PaperBLAST