VIMSS161646 has 214 amino acids
Query: DUF3310 [M=59]
Accession: PF11753.12
Description: Protein of unknwon function (DUF3310)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.3e-27 80.0 1.4 1.3e-26 78.8 1.4 1.7 1 VIMSS161646
Domain annotation for each sequence (and alignments):
>> VIMSS161646
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.8 1.4 1.3e-26 1.3e-26 1 59 [] 149 205 .. 149 205 .. 0.96
Alignments for each domain:
== domain 1 score: 78.8 bits; conditional E-value: 1.3e-26
DUF3310 1 vnkPkHYtkgdiEvIdvieekltgeefkgfllgNviKYvlRakkKngleDlkKakwYld 59
vn+P+HYt g+iE++d+i++k+++ + ++++gN++KYv+R+++Kng+eDlkKa++Yl+
VIMSS161646 149 VNNPAHYTAGGIETLDYIKAKVND--YPSYAVGNILKYVSRYEHKNGIEDLKKAQFYLN 205
8*******************9888..66*****************************97 PP
Or compare VIMSS161646 to CDD or PaperBLAST