Q9P2Q2 has 1039 amino acids
Query: CUPID [M=136] Accession: PF11819.12 Description: Cytohesin Ubiquitin Protein Inducing Domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-64 201.2 4.9 3.5e-64 201.2 4.9 2.1 2 Q9P2Q2 Domain annotation for each sequence (and alignments): >> Q9P2Q2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 201.2 4.9 3.5e-64 3.5e-64 2 136 .] 357 491 .. 356 491 .. 0.99 2 ? -2.2 0.3 0.23 0.23 7 28 .. 951 972 .. 943 988 .. 0.59 Alignments for each domain: == domain 1 score: 201.2 bits; conditional E-value: 3.5e-64 CUPID 2 skgelissssgsllssgsdesessekdkkeklralkkkqkaLqekLelkleELkklClrEAeLtGklpkeypLepgekppqvrRrigaafkldeekilqkeed 104 skg++is+ssgsllssgs+es+ss+++kk++l+alk++q+aL+e+L+++leELkklClrEAeLtGklp eypL+pge+pp vrRrig+afklde+kil+k e+ Q9P2Q2 357 SKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEE 459 89***************************************************************************************************** PP CUPID 105 peLesLerelalqqqiveAarrLaeeenlske 136 +eLe+Lere+a+q+qi+eAarrLa+++n+sk+ Q9P2Q2 460 AELERLEREFAIQSQITEAARRLASDPNVSKK 491 ******************************96 PP == domain 2 score: -2.2 bits; conditional E-value: 0.23 CUPID 7 issssgsllssgsdesessekd 28 ss+sgs s+ s+++ + ++ Q9P2Q2 951 TSSDSGSQYSTSSQSTFVAHSR 972 4566666666666665555543 PP
Or compare Q9P2Q2 to CDD or PaperBLAST