SwissProt::Q7TN12 has 663 amino acids
Query: CUPID [M=136] Accession: PF11819.12 Description: Cytohesin Ubiquitin Protein Inducing Domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-58 182.3 4.6 4.7e-58 181.3 4.6 1.5 1 SwissProt::Q7TN12 Domain annotation for each sequence (and alignments): >> SwissProt::Q7TN12 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 181.3 4.6 4.7e-58 4.7e-58 1 136 [] 87 216 .. 87 216 .. 0.96 Alignments for each domain: == domain 1 score: 181.3 bits; conditional E-value: 4.7e-58 CUPID 1 eskgelissssgsllssgsdesessekdkkeklralkkkqkaLqekLelkleELkklClrEAeLtGklpkeypLepgekppqvrRrigaafk 92 esk+e+++s+sg++l+sg+d++ s++k e ++a++k+q+aL+++Le++leEL++lClrEAeLtG+lp+eypL+pgek+p+vrRrigaa+k SwissProt::Q7TN12 87 ESKDEVSDSDSGIILQSGPDSPVSPMK---ELTNAVRKQQRALEARLEACLEELRRLCLREAELTGTLPAEYPLKPGEKAPKVRRRIGAAYK 175 79*************************...669*********************************************************** PP CUPID 93 ldeekilqkeedpeLesLerelalqqqiveAarrLaeeenlske 136 lde++++ +edp L+sLer+lalq qi+eAarrL+ eenls++ SwissProt::Q7TN12 176 LDEWALH--REDP-LSSLERQLALQLQITEAARRLCAEENLSRQ 216 ***7555..5999.***************************986 PP
Or compare SwissProt::Q7TN12 to CDD or PaperBLAST