SwissProt::Q8BIE6 has 1020 amino acids
Query: CUPID [M=136] Accession: PF11819.12 Description: Cytohesin Ubiquitin Protein Inducing Domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-64 200.9 4.7 4.2e-64 200.9 4.7 2.1 2 SwissProt::Q8BIE6 Domain annotation for each sequence (and alignments): >> SwissProt::Q8BIE6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 200.9 4.7 4.2e-64 4.2e-64 2 136 .] 342 476 .. 341 476 .. 0.99 2 ? -2.2 0.3 0.22 0.22 7 28 .. 932 953 .. 924 969 .. 0.59 Alignments for each domain: == domain 1 score: 200.9 bits; conditional E-value: 4.2e-64 CUPID 2 skgelissssgsllssgsdesessekdkkeklralkkkqkaLqekLelkleELkklClrEAeLtGklpkeypLepgekppqvrRrigaafkl 93 skg++is+ssgsllssgs+es+ss+++kk++l+alk++q+aL+e+L+++leELk+lClrEAeLtGklp eypL+pge+pp vrRrig+afkl SwissProt::Q8BIE6 342 SKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKRLCLREAELTGKLPVEYPLDPGEEPPIVRRRIGTAFKL 433 89****************************************************************************************** PP CUPID 94 deekilqkeedpeLesLerelalqqqiveAarrLaeeenlske 136 de+kil+k e++eLe+Lere+a+q+qi+eAarrLa+++n+sk+ SwissProt::Q8BIE6 434 DEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKK 476 *****************************************96 PP == domain 2 score: -2.2 bits; conditional E-value: 0.22 CUPID 7 issssgsllssgsdesessekd 28 ss+sgs s+ s+++ + ++ SwissProt::Q8BIE6 932 TSSDSGSQYSTSSQSTFVAHSR 953 4566666666666665555543 PP
Or compare SwissProt::Q8BIE6 to CDD or PaperBLAST