SwissProt::Q920B0 has 1035 amino acids
Query: CUPID [M=136] Accession: PF11819.12 Description: Cytohesin Ubiquitin Protein Inducing Domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-59 185.8 7.4 4.8e-59 184.5 7.4 1.7 1 SwissProt::Q920B0 Domain annotation for each sequence (and alignments): >> SwissProt::Q920B0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 184.5 7.4 4.8e-59 4.8e-59 1 136 [] 395 529 .. 395 529 .. 0.98 Alignments for each domain: == domain 1 score: 184.5 bits; conditional E-value: 4.8e-59 CUPID 1 eskgelissssgsllssgsdesessekdkkeklralkkkqkaLqekLelkleELkklClrEAeLtGklpkeypLepgekppqvrRrigaafk 92 e+k+++i++s+gsl+ssgs++se e++k+ek+ +lkkk+k LqekL +k+eELkk+ClrEAeLtG++pkeypL+ gekppqvrRr+g++fk SwissProt::Q920B0 395 EAKSQFIMASNGSLISSGSQDSEGMEEQKREKILELKKKEKLLQEKLLQKVEELKKICLREAELTGRMPKEYPLNIGEKPPQVRRRVGTTFK 486 6799**************************************************************************************** PP CUPID 93 ldeekilqkeedpeLesLerelalqqqiveAarrLaeeenlske 136 ld+ ++l++eedp+L++Le+++ +qq++veAa++La+e++l+k+ SwissProt::Q920B0 487 LDD-NLLPTEEDPALQELESNFLIQQKLVEAAKKLASEPDLCKT 529 ***.58999*********************************95 PP
Or compare SwissProt::Q920B0 to CDD or PaperBLAST