Q9NZV8 has 630 amino acids
Query: DUF3399 [M=77]
Accession: PF11879.11
Description: Domain of unknown function (DUF3399)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.9e-42 128.4 10.3 1.5e-41 127.1 10.3 1.7 1 Q9NZV8
Domain annotation for each sequence (and alignments):
>> Q9NZV8
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 127.1 10.3 1.5e-41 1.5e-41 3 76 .. 472 545 .. 470 546 .. 0.97
Alignments for each domain:
== domain 1 score: 127.1 bits; conditional E-value: 1.5e-41
DUF3399 3 sllEsqHHHLLhCLEKTTnheFvdEqlyeqnclevslqkrpssrspslssqeglsssCCsrrakkstrlpnssv 76
s++E+qHHHLLhCLEKTTnheFvdEq++e++c+ev++ +rpss+spslssq+g++s+CCsrr+kk++r+pn++v
Q9NZV8 472 SSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANV 545
89*********************************************************************997 PP
Or compare Q9NZV8 to CDD or PaperBLAST