PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P59995 to PF11879 (DUF3399)

SwissProt::P59995 has 630 amino acids

Query:       DUF3399  [M=77]
Accession:   PF11879.11
Description: Domain of unknown function (DUF3399)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    5.9e-42  128.4  10.3    1.5e-41  127.1  10.3    1.7  1  SwissProt::P59995  


Domain annotation for each sequence (and alignments):
>> SwissProt::P59995  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  127.1  10.3   1.5e-41   1.5e-41       3      76 ..     472     545 ..     470     546 .. 0.97

  Alignments for each domain:
  == domain 1  score: 127.1 bits;  conditional E-value: 1.5e-41
            DUF3399   3 sllEsqHHHLLhCLEKTTnheFvdEqlyeqnclevslqkrpssrspslssqeglsssCCsrrakkstrlpnssv 76 
                        s++E+qHHHLLhCLEKTTnheFvdEq++e++c+ev++ +rpss+spslssq+g++s+CCsrr+kk++r+pn++v
  SwissProt::P59995 472 SSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANV 545
                        89*********************************************************************997 PP



Or compare SwissProt::P59995 to CDD or PaperBLAST