XP_015132111.1 has 632 amino acids
Query: DUF3399 [M=77]
Accession: PF11879.11
Description: Domain of unknown function (DUF3399)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.7e-41 124.5 8.5 2.6e-40 123.2 8.5 1.8 1 XP_015132111.1
Domain annotation for each sequence (and alignments):
>> XP_015132111.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 123.2 8.5 2.6e-40 2.6e-40 3 75 .. 474 546 .. 472 548 .. 0.97
Alignments for each domain:
== domain 1 score: 123.2 bits; conditional E-value: 2.6e-40
DUF3399 3 sllEsqHHHLLhCLEKTTnheFvdEqlyeqnclevslqkrpssrspslssqeglsssCCsrrakkstrlpnss 75
s++E+qHHHLLhCLEKTTnheFvdEqlye++c+evs+ +rp s+spslssq+g++ +CCsrr+kk+ r+pn+
XP_015132111.1 474 SSFETQHHHLLHCLEKTTNHEFVDEQLYEESCMEVSTVNRPPSHSPSLSSQQGVTGTCCSRRHKKTYRIPNTA 546
89*********************************************************************86 PP
Or compare XP_015132111.1 to CDD or PaperBLAST