XP_026693459.1 has 800 amino acids
Query: DUF3399 [M=76]
Accession: PF11879.12
Description: Domain of unknown function (DUF3399)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.1e-10 26.7 12.0 3.1e-10 26.7 12.0 3.0 3 XP_026693459.1
Domain annotation for each sequence (and alignments):
>> XP_026693459.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 26.7 12.0 3.1e-10 3.1e-10 3 55 .. 477 528 .. 475 569 .. 0.78
2 ? -1.7 2.7 0.23 0.23 38 59 .. 557 578 .. 547 580 .. 0.71
3 ? -3.6 2.0 0.88 0.88 43 58 .. 674 689 .. 662 695 .. 0.68
Alignments for each domain:
== domain 1 score: 26.7 bits; conditional E-value: 3.1e-10
DUF3399 3 sllEsQHHHLLhCLEKTTnheFvdEqtyeenclevslqkrpsrspslssqegl 55
++E+ H HLLhCLE+TT+he ++ q+ + +++ +s sl s +++
XP_026693459.1 477 ATFEKNHFHLLHCLERTTDHEITENQMCNS-TSVIAIRGGDNESESLISTHSA 528
58*************************984.4555666666677776665443 PP
== domain 2 score: -1.7 bits; conditional E-value: 0.23
DUF3399 38 slqkrpsrspslssqegltssC 59
+ +srs+s+s + ++C
XP_026693459.1 557 RHNDVSSRSSSVSHTSQHDNAC 578
4556788999999877766666 PP
== domain 3 score: -3.6 bits; conditional E-value: 0.88
DUF3399 43 psrspslssqegltss 58
+ +slss+++ +s+
XP_026693459.1 674 SVPMTSLSSSDASSST 689
4466788888666554 PP
Or compare XP_026693459.1 to CDD or PaperBLAST