XP_026693459.1 has 800 amino acids
Query: DUF3399 [M=77]
Accession: PF11879.11
Description: Domain of unknown function (DUF3399)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.8e-10 26.2 12.3 4.8e-10 26.2 12.3 3.0 3 XP_026693459.1
Domain annotation for each sequence (and alignments):
>> XP_026693459.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 26.2 12.3 4.8e-10 4.8e-10 3 55 .. 477 527 .. 475 569 .. 0.69
2 ? -1.3 3.0 0.18 0.18 40 60 .. 558 578 .. 546 580 .. 0.72
3 ? -3.5 1.9 0.9 0.9 46 59 .. 676 689 .. 665 696 .. 0.58
Alignments for each domain:
== domain 1 score: 26.2 bits; conditional E-value: 4.8e-10
DUF3399 3 sllEsqHHHLLhCLEKTTnheFvdEqlyeqnclevslqkrpssrspslssqeg 55
++E+ H HLLhCLE+TT+he ++ q+ + + + ++ +s sl s ++
XP_026693459.1 477 ATFEKNHFHLLHCLERTTDHEITENQMCNSTSVI-AIRGGDN-ESESLISTHS 527
589************************9965554.4444444.4555555533 PP
== domain 2 score: -1.3 bits; conditional E-value: 0.18
DUF3399 40 qkrpssrspslssqeglsssC 60
++ ssrs+s+s + ++C
XP_026693459.1 558 HNDVSSRSSSVSHTSQHDNAC 578
4567889***99887766666 PP
== domain 3 score: -3.5 bits; conditional E-value: 0.9
DUF3399 46 rspslssqeglsss 59
+slss+++ ss+
XP_026693459.1 676 PMTSLSSSDASSST 689
44566666444433 PP
Or compare XP_026693459.1 to CDD or PaperBLAST