F8W1K5 has 102 amino acids
Query: DUF3456 [M=150]
Accession: PF11938.12
Description: TLR4 regulator and MIR-interacting MSAP
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-32 99.2 0.0 1.7e-32 99.1 0.0 1.0 1 F8W1K5
Domain annotation for each sequence (and alignments):
>> F8W1K5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 99.1 0.0 1.7e-32 1.7e-32 27 130 .. 1 101 [. 1 102 [] 0.91
Alignments for each domain:
== domain 1 score: 99.1 bits; conditional E-value: 1.7e-32
DUF3456 27 vggfrldkkgkrkkkkikyakSelrltelleevCekmldYnlhkekktskrtlkrlasrkgvkvelgikyelwdedsaevnkslkkaCerlvEeyEdeieel 128
+g+fr++++g+++ +++ya+Se++ltellee+C++m++Y ++ +++t+++ ++r+ r+g++ el + + ++ d ++++ +lk+aCe++vEeyEde++e+
F8W1K5 1 MGSFRINPDGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSEL--DLQGIRID-SDISGTLKFACESIVEEYEDELIEF 99
689********************************************************9977655..55555556.668899******************9 PP
DUF3456 129 yk 130
++
F8W1K5 100 FS 101
97 PP
Or compare F8W1K5 to CDD or PaperBLAST