F8W1K5 has 102 amino acids
Query: DUF3456 [M=151]
Accession: PF11938.11
Description: TLR4 regulator and MIR-interacting MSAP
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-30 93.2 0.0 1.3e-30 93.1 0.0 1.0 1 F8W1K5
Domain annotation for each sequence (and alignments):
>> F8W1K5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 93.1 0.0 1.3e-30 1.3e-30 27 131 .. 1 101 [. 1 102 [] 0.90
Alignments for each domain:
== domain 1 score: 93.1 bits; conditional E-value: 1.3e-30
DUF3456 27 vggfrldkkgkrkkkkikyakSElrltellenvCekmldYnlhkerktkkrtlkrlksrakgvkveldikyeawdeksaevskelkkaCerlveeyEdeiee 128
+g+fr++++g+++ +++ya+SE++ltelle++C++m++Y ++ +++t++++++r+ r +g+ el + + ++ + +++s +lk+aCe++veeyEde++e
F8W1K5 1 MGSFRINPDGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGR-NGESSEL--DLQGIRID-SDISGTLKFACESIVEEYEDELIE 98
689*******************************************************9.7766655..55555555.557789****************** PP
DUF3456 129 lyk 131
+++
F8W1K5 99 FFS 101
986 PP
Or compare F8W1K5 to CDD or PaperBLAST