Q1LZ72 has 182 amino acids
Query: DUF3456 [M=151] Accession: PF11938.11 Description: TLR4 regulator and MIR-interacting MSAP Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-48 150.9 0.7 2.4e-48 150.6 0.7 1.0 1 Q1LZ72 Domain annotation for each sequence (and alignments): >> Q1LZ72 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.6 0.7 2.4e-48 2.4e-48 1 151 [] 27 171 .. 27 171 .. 0.92 Alignments for each domain: == domain 1 score: 150.6 bits; conditional E-value: 2.4e-48 DUF3456 1 kCeaCkavadeleealsktdpkkevdvggfrldkkgkrkkkkikyakSElrltellenvCekmldYnlhkerktkkrtlkrlksrakgvkveldikyeawde 102 +C+aC+a++dele++++++dpkk++++g+fr++++g+++ +++ya+SE++ltelle+vC++m++Y ++ +++t++++++r+ r +g+ el + + ++ Q1LZ72 27 HCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEVCDRMKEYGEQIDPSTHRKNYVRVVGR-NGESSEL--DLQGIRI 125 6***********************************************************************************9.7766655..5555555 PP DUF3456 103 ksaevskelkkaCerlveeyEdeieelykkeqeeeelekkLCeersklC 151 + +++s +lk+aCe++veeyEde++e++++ + +++++kLC++r++lC Q1LZ72 126 D-SDISGTLKFACESIVEEYEDELIEFFSR-EA-DNVKDKLCSKRTDLC 171 5.557789*********************9.33.58***********99 PP
Or compare Q1LZ72 to CDD or PaperBLAST