VIMSS10081514 has 615 amino acids
Query: DUF3475 [M=57]
Accession: PF11961.12
Description: Domain of unknown function (DUF3475)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-25 74.7 1.3 7.5e-25 73.1 1.3 1.9 1 VIMSS10081514
Domain annotation for each sequence (and alignments):
>> VIMSS10081514
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.1 1.3 7.5e-25 7.5e-25 1 57 [] 136 192 .. 136 192 .. 0.99
Alignments for each domain:
== domain 1 score: 73.1 bits; conditional E-value: 7.5e-25
DUF3475 1 iLAFEvAnlmsKlvhLwqsLsdkevarLreeilrseGVkkLvSeDesfLlrLalaEk 57
iLAFEvAn+++K++ L+qsLs+++++ +++++l+se VkkLvS+D+++L La+++k
VIMSS10081514 136 ILAFEVANTIAKGAALLQSLSEENLKFMKKDMLHSEEVKKLVSTDTTELQILAASDK 192
9*****************************************************996 PP
Or compare VIMSS10081514 to CDD or PaperBLAST