VIMSS10081514 has 615 amino acids
Query: DUF3475 [M=57] Accession: PF11961.12 Description: Domain of unknown function (DUF3475) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-25 74.7 1.3 7.5e-25 73.1 1.3 1.9 1 VIMSS10081514 Domain annotation for each sequence (and alignments): >> VIMSS10081514 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.1 1.3 7.5e-25 7.5e-25 1 57 [] 136 192 .. 136 192 .. 0.99 Alignments for each domain: == domain 1 score: 73.1 bits; conditional E-value: 7.5e-25 DUF3475 1 iLAFEvAnlmsKlvhLwqsLsdkevarLreeilrseGVkkLvSeDesfLlrLalaEk 57 iLAFEvAn+++K++ L+qsLs+++++ +++++l+se VkkLvS+D+++L La+++k VIMSS10081514 136 ILAFEVANTIAKGAALLQSLSEENLKFMKKDMLHSEEVKKLVSTDTTELQILAASDK 192 9*****************************************************996 PP
Or compare VIMSS10081514 to CDD or PaperBLAST