VIMSS10104366 has 599 amino acids
Query: DUF3475 [M=57]
Accession: PF11961.12
Description: Domain of unknown function (DUF3475)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.5e-31 92.3 0.8 1.9e-30 91.1 0.8 1.8 1 VIMSS10104366
Domain annotation for each sequence (and alignments):
>> VIMSS10104366
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.1 0.8 1.9e-30 1.9e-30 1 57 [] 28 84 .. 28 84 .. 0.98
Alignments for each domain:
== domain 1 score: 91.1 bits; conditional E-value: 1.9e-30
DUF3475 1 iLAFEvAnlmsKlvhLwqsLsdkevarLreeilrseGVkkLvSeDesfLlrLalaEk 57
+LAFEvA+l+sKlvhLwqsLsdk+varLr+ei++s G+kkLvSeD++f++rL+ E+
VIMSS10104366 28 VLAFEVASLLSKLVHLWQSLSDKNVARLRDEITHSTGIKKLVSEDDDFIVRLIRDEM 84
8****************************************************9886 PP
Or compare VIMSS10104366 to CDD or PaperBLAST