VIMSS10109631 has 474 amino acids
Query: DUF3475 [M=57]
Accession: PF11961.12
Description: Domain of unknown function (DUF3475)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-24 70.8 0.3 1.4e-23 69.0 0.3 2.1 1 VIMSS10109631
Domain annotation for each sequence (and alignments):
>> VIMSS10109631
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 69.0 0.3 1.4e-23 1.4e-23 1 57 [] 39 95 .. 39 95 .. 0.99
Alignments for each domain:
== domain 1 score: 69.0 bits; conditional E-value: 1.4e-23
DUF3475 1 iLAFEvAnlmsKlvhLwqsLsdkevarLreeilrseGVkkLvSeDesfLlrLalaEk 57
+L+FEvA++m+Kl+hL++sL+d+++ + r++ l++eG++k+v+ De+f+l+L++aE+
VIMSS10109631 39 VLSFEVARVMTKLLHLTHSLTDSNLLTPRDHSLSLEGLTKIVNGDETFHLSLVCAEL 95
8******************************************************95 PP
Or compare VIMSS10109631 to CDD or PaperBLAST