PaperBLAST – Find papers about a protein or its homologs

 

Align A5XB26 to PF11999 (Ice_binding)

A5XB26 has 253 amino acids

Query:       Ice_binding  [M=208]
Accession:   PF11999.12
Description: Ice-binding-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.5e-66  208.9   8.1    3.5e-66  208.9   8.1    1.4  2  A5XB26    


Domain annotation for each sequence (and alignments):
>> A5XB26  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.8   0.0      0.22      0.22     168     179 ..      18      29 ..      14      39 .. 0.74
   2 !  208.9   8.1   3.5e-66   3.5e-66       1     208 []      43     242 ..      43     242 .. 0.95

  Alignments for each domain:
  == domain 1  score: -2.8 bits;  conditional E-value: 0.22
  Ice_binding 168 gstfeGnilaqt 179
                  gs f+Gn++a  
       A5XB26  18 GSIFAGNVMAAG 29 
                  678888888865 PP

  == domain 2  score: 208.9 bits;  conditional E-value: 3.5e-66
  Ice_binding   1 ilaksgitntGttvitGdiGvspaaataitGfallasgestsglvltGkvyaadaa......aatpatltqAvadletAyndaagrttpaltelgage 92 
                  il+ksgit + ++++tG++G+sp+     tG al      ++ +v tG++y+ d a       + p  l+ Av+d+ +Ayndaagr++ + telg+ge
       A5XB26  43 ILSKSGITDVYPSTVTGNVGTSPI-----TGAAL----LLNCDEV-TGAMYTVDSAgplpcsINSPYLLELAVSDMGIAYNDAAGRVPADHTELGTGE 130
                  79*********************9.....78884....3467888.7999999999787777556899****************************** PP

  Ice_binding  93 lggltltpGvYkstssvtistgdltLDaqgdanavwiFqiastLttasgssvvLinGAqaknvfWqVggsatlgtgstfeGnilaqtsitlntgatvn 190
                  +ggltl+pGvYk++s+v+ist d+t+  +g  ++vwi+qi+++L++a++++v+L++GA akn+fWqV+g ++lgt ++feG++l++t i++ntg+tvn
       A5XB26 131 IGGLTLEPGVYKWSSDVNIST-DVTF--NGTMDDVWIMQISGNLNQANAKRVTLTGGALAKNIFWQVAGYTALGTYASFEGIVLSKTLISVNTGTTVN 225
                  *******************77.****..********************************************************************** PP

  Ice_binding 191 GrllaqtgaVtLdnntit 208
                  Grllaqt aVtL++nti+
       A5XB26 226 GRLLAQT-AVTLQKNTIN 242
                  *******.********96 PP



Or compare A5XB26 to CDD or PaperBLAST