VIMSS1783316 has 368 amino acids
Query: Ice_binding [M=208] Accession: PF11999.12 Description: Ice-binding-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-78 247.7 19.4 4.5e-78 247.7 19.4 2.2 2 VIMSS1783316 Domain annotation for each sequence (and alignments): >> VIMSS1783316 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 4.9 0.098 0.098 7 76 .. 84 119 .. 41 160 .. 0.46 2 ! 247.7 19.4 4.5e-78 4.5e-78 2 208 .] 164 366 .. 163 366 .. 0.98 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.098 Ice_binding 7 itntGttvitGdiGvspaaataitGfallasgestsglvltGkvyaadaaaatpatltqAvadletAynd 76 + +Gt+vi G + + ++at + d++t y++ VIMSS1783316 84 VVKKGTAVIPGTVSYTGTTATFNPSVV----------------------------------LDANTVYTA 119 223333333333333333222222222..................................111111111 PP == domain 2 score: 247.7 bits; conditional E-value: 4.5e-78 Ice_binding 2 laksgitntGttvitGdiGvspaaataitGfall.asgestsglvltGkvyaadaaaatpatltqAvadletAyndaagrttpaltelgagelgglt 97 lak++i n++t+++tG iG+spaa+++itGf+l+ a+g++ts++v tG+++aad++++t+++lt+A++d++tAy+daagr+tp++ elg+g++gg+t VIMSS1783316 164 LAKTAINNNPTSAVTGAIGLSPAATSYITGFSLTnATGYATSSQV-TGHIFAADMVSPTSSNLTTAINDMQTAYTDAAGRKTPDYVELGTGNIGGKT 259 8*******************************964667*******.8************************************************** PP Ice_binding 98 ltpGvYkstssvtistgdltLDaqgdanavwiFqiastLttasgssvvLinGAqaknvfWqVggsatlgtgstfeGnilaqtsitlntgatvnGrll 194 l+pG+Yk+tssv++++ d+t+ +g+an+vwiFqi+++L+ ++g++++L++GAqakn+fWqV+g++t gt+s++eG+il++t+it+ntga+++Gr+l VIMSS1783316 260 LQPGLYKWTSSVSVPS-DVTI--SGGANDVWIFQISGNLSLSAGAKITLSGGAQAKNIFWQVAGTVTAGTTSHIEGVILSKTGITFNTGASLKGRAL 353 **************66.****..************************************************************************** PP Ice_binding 195 aqtgaVtLdnntit 208 aqt a+ Ld nt+t VIMSS1783316 354 AQT-AIILDGNTVT 366 ***.9*******96 PP
Or compare VIMSS1783316 to CDD or PaperBLAST