VIMSS1975379 has 258 amino acids
Query: Ice_binding [M=208] Accession: PF11999.12 Description: Ice-binding-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-69 219.4 12.8 2.6e-69 219.1 12.8 1.1 1 VIMSS1975379 Domain annotation for each sequence (and alignments): >> VIMSS1975379 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 219.1 12.8 2.6e-69 2.6e-69 1 208 [] 44 243 .. 44 243 .. 0.94 Alignments for each domain: == domain 1 score: 219.1 bits; conditional E-value: 2.6e-69 Ice_binding 1 ilaksgitntGttvitGdiGvspaaataitGfallasgestsglvltGkvyaadaa......aatpatltqAvadletAyndaagrttpaltelgag 91 +l+ksgitn++ +++tGd+G+sp+ tG a + t+++v G++ya+da+ ++p tl +A+ d+ +Ayndaagr++p+ telgag VIMSS1975379 44 VLSKSGITNVSDSIVTGDVGASPI-----TGAA----TLLTCSEV-VGDIYATDANgpapcsINAPGTLGSAIGDMGIAYNDAAGRVSPDETELGAG 130 799********************9.....6666....23456777.5*********888887445799***************************** PP Ice_binding 92 elggltltpGvYkstssvtistgdltLDaqgdanavwiFqiastLttasgssvvLinGAqaknvfWqVggsatlgtgstfeGnilaqtsitlntgat 188 e+ggltltpG+Yk++++v i t+d+tL +g+a++vwi+qia+tL++a+ ++v+L++GA a+nvfWqV+ s+t+gtg++feG+il q+ i++ntgat VIMSS1975379 131 EIGGLTLTPGLYKWSTDVGI-TSDVTL--KGNATDVWILQIAGTLSQAAYKNVTLAGGALAENVFWQVADSVTIGTGAHFEGIILGQKLIAVNTGAT 224 ********************.77****..******************************************************************** PP Ice_binding 189 vnGrllaqtgaVtLdnntit 208 v+Grl+aqt aVtL++n+it VIMSS1975379 225 VKGRLFAQT-AVTLQKNKIT 243 *********.*******996 PP
Or compare VIMSS1975379 to CDD or PaperBLAST