VIMSS2781440 has 265 amino acids
Query: Ice_binding [M=208] Accession: PF11999.12 Description: Ice-binding-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-65 207.3 8.8 1.3e-65 207.1 8.8 1.1 1 VIMSS2781440 Domain annotation for each sequence (and alignments): >> VIMSS2781440 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 207.1 8.8 1.3e-65 1.3e-65 1 208 [] 64 263 .. 64 263 .. 0.93 Alignments for each domain: == domain 1 score: 207.1 bits; conditional E-value: 1.3e-65 Ice_binding 1 ilaksgitntGttvitGdiGvspaaataitGfallasgestsglvltGkvyaadaa......aatpatltqAvadletAyndaagrttpaltelgag 91 il++sg+t + +++itGd+G sp++ +ai t+++v +G++y +aa + ++ lt+Av d+ tAy+daagr++p++ elgag VIMSS2781440 64 ILSQSGVTDVYPSIITGDVGSSPITGAAILV---------TCAEV-EGTIYSVNAAgplpcvVNSATRLTTAVGDMGTAYTDAAGRSNPDYLELGAG 150 799*********************5555444.........55778.6999999988888877556789***************************** PP Ice_binding 92 elggltltpGvYkstssvtistgdltLDaqgdanavwiFqiastLttasgssvvLinGAqaknvfWqVggsatlgtgstfeGnilaqtsitlntgat 188 ++gg tl+pG+Yk+ts + i+ +d+t+ +g++++vwiFqi++tL ++s+ +++L++GAqakn+fWqV+g++tlgt+s+feG+il +t+i++ tgat VIMSS2781440 151 NIGGFTLEPGLYKWTSPLIIP-ADITI--SGGPEDVWIFQISQTLIMSSAVRITLSGGAQAKNIFWQVAGAVTLGTTSHFEGIILGKTGINMLTGAT 244 ********************5.5****..******************************************************************** PP Ice_binding 189 vnGrllaqtgaVtLdnntit 208 nGr+laqt aV L+ +tit VIMSS2781440 245 SNGRMLAQT-AVVLQMATIT 263 *********.9*****9996 PP
Or compare VIMSS2781440 to CDD or PaperBLAST