PaperBLAST – Find papers about a protein or its homologs

 

Align P32399 to PF12051 (DUF3533)

P32399 has 775 amino acids

Query:       DUF3533  [M=376]
Accession:   PF12051.11
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.2e-16   45.8  20.1      9e-13   33.9   0.0    2.9  3  P32399    


Domain annotation for each sequence (and alignments):
>> P32399  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.9   0.0     9e-13     9e-13      14     173 ..      33     178 ..      17     199 .. 0.77
   2 ?   -1.5   0.6     0.052     0.052      78     159 ..     405     487 ..     320     498 .. 0.64
   3 !   17.2  11.0   1.1e-07   1.1e-07     236     375 ..     616     752 ..     561     753 .. 0.77

  Alignments for each domain:
  == domain 1  score: 33.9 bits;  conditional E-value: 9e-13
  DUF3533  14 siywGalyrrsdrlknlnvlvVneDeg...gselepvvgeavakiiketassslgtwkvinssefkesekeveelvhkekywgalvvkenatealyaalasa 112
               ++  a++++   + +l+v+vVn+D+g   ++e  ++  + v++++++++     +w++ n      + ++  +++ ++ky++++ ++e+++++ ++ l ++
   P32399  33 GVFLKAYWDPYGTVDQLPVVVVNQDKGatyEGEKLQIGDDLVKELKDNNN----FDWHFSN------DLDQSLKDLLNQKYYLVVEIPEDFSKNASTVL-DK 123
              3566678888999**************99555555666666666555555....8999987......88888899999*********************.33 PP

  DUF3533 113 ngassynstellelvyesgrdptnvksyi.lpiltqleaaalskyskellqslikslsnssq 173
              n +        l+l y ++   + v   i ++++++l+a + +++++++++ +  +++++++
   P32399 124 NPK-------KLDLKYHTNAGSNYVGATIgEKAIDKLKASVSKEVTEQYTKVIFDNFKDIAK 178
              322.......46677777777777777763688999*****************999998876 PP

  == domain 2  score: -1.5 bits;  conditional E-value: 0.052
  DUF3533  78 sekeveelvhkekywga.lvvkenatealyaalasangassynstellelvyesgrdptnvksyilpiltqleaaals.kyske 159
              + + +++++ + k+  a +   ++at++ly+   ++ +++  + te ++ +y+ +++ t  ++ ++  + + ++++++ k ++e
   P32399 405 DIATIKSSLEDVKAQVAqVKAMPEATSKLYNGA-KTIQDAIDRLTEGADKIYNGSQKLTDGQTKLTAGIGEYNKQFAKaKAGSE 487
              444444444444444432556688888888888.55566566667888888888888888888888777777777766455555 PP

  == domain 3  score: 17.2 bits;  conditional E-value: 1.1e-07
  DUF3533 236 kqllvyrllisvislfvlSLffslvslafqvdftvafGragFvvyWmitwlvmlavglanenvasil..gppylpvwllfwvilNvsttfvPlelspgFYry 335
               +++++++ + +++  + SL++ +v  +++++ +v+     F v+ +it+l++la++   + +a+ +  + ++++v++l+   l  s +++Plel+p+FY++
   P32399 616 FEWFFSKFNVMMLVGIIQSLIVATVL-LLGIGLEVESTW-RFYVFTIITSLAFLAII---QFLATTMgnPGRFIAVIILV-LQLGASGGTFPLELLPNFYQV 711
              56777888888888888888887774.445555554443.57777777776666654...55566663244555555444.45677889************* PP

  DUF3533 336 gyal.PlhniveilrvIffdtskgqlgrnlGiLfaWvvvnt 375
               +   P+ +++++ r +++++  g +   +G+L++  +v++
   P32399 712 IHGAlPMTYSINGFRAVISNGDFGYMWQMAGVLIGIALVMI 752
              99766*****************************9888775 PP



Or compare P32399 to CDD or PaperBLAST