PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1100263 to PF12051 (DUF3533)

VIMSS1100263 has 915 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.2e-13   35.9  17.4    1.4e-12   33.2   1.6    3.3  4  VIMSS1100263  


Domain annotation for each sequence (and alignments):
>> VIMSS1100263  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.2   1.6   1.4e-12   1.4e-12       8     170 ..      27     180 ..      20     232 .. 0.76
   2 ?   -2.3   1.0     0.086     0.086     134     175 ..     389     410 ..     313     448 .. 0.59
   3 ?   -3.1   0.3      0.16      0.16      41      62 ..     526     547 ..     481     580 .. 0.52
   4 !   17.1   8.3   1.2e-07   1.2e-07     144     376 ..     659     886 ..     652     888 .. 0.69

  Alignments for each domain:
  == domain 1  score: 33.2 bits;  conditional E-value: 1.4e-12
       DUF3533   8 lilailsly....wGalyrrsdrlknlnvlvVneDeg..gseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgaivvk 98 
                     + i sly    + al ++ +++++l+v+v  +D+   + + + ++g+++ ++++++    +  w++ +      s++++ e v ++ky++ i+v+
  VIMSS1100263  27 ALIIIPSLYawfnIWALWDPYSKTQDLKVAVYSADQSvtVAKKKVAIGDELIDQLKKND---KLGWQFTS------SKKQLDEGVKTGKYYAGIYVP 114
                   4444444443222358899999***************8878888888888888777776...35598887......9******************** PP

       DUF3533  99 enateklyaal.sangassynstelleliyesgRdattvssyilpa.ltqleaaalakygsqllqqliqslsnt 170
                   +n++++l + +  + +    ++t    +iy s+ + ++++  i++a +t+l+++  +++++++ ++l++sl++ 
  VIMSS1100263 115 KNFSKDLISFVdGKIQ----KPT----IIYSSNDKINAIAPKITSAgATTLQSTISEELVQTVAKTLMSSLNKA 180
                   ***********33333....345....88888888887777776643677777777788888887777777754 PP

  == domain 2  score: -2.3 bits;  conditional E-value: 0.086
       DUF3533 134 ttvssyilpaltqleaaalakygsqllqqliqslsntaqaaq 175
                   + ++++++++l+ql+a  +                      q
  VIMSS1100263 389 QELKAALKTNLEQLSAHTAT--------------------LQ 410
                   33333333333333333322....................22 PP

  == domain 3  score: -3.1 bits;  conditional E-value: 0.16
       DUF3533  41 gseltpvvgeavaqainettss 62 
                    ++++ +v + + +++++t+++
  VIMSS1100263 526 LNQINTAVLPKLPSLLTNTQKT 547
                   3333334444444444444433 PP

  == domain 4  score: 17.1 bits;  conditional E-value: 1.2e-07
       DUF3533 144 ltqleaaalakygsqllqqliqslsntaqaaqlsnallaspiafnsidlrPftd.gvalaplqvgliyliiltffqfaflgklhaemg..lsrklkf 237
                   +++ ++a ++++ +  l++li+ l   a+++++    la+p++++s  + P++  g+a ap  ++ ++++ +    ++ +  ++ ++   ++++ + 
  VIMSS1100263 659 IQKGAEAIRKQQKTVDLKDLIKLLRRDATKESN---FLAEPVKLQSKHVYPIKTyGSASAP--FYTALCLWVGALLLSNIVLTNFSLDdkQKERYSK 750
                   666677777777777777778777777777664...9999999999999998651455555..8888888887777666666666664433444444 PP

       DUF3533 238 kqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvyWmitwlvmaavglanenvasilgppylpvwllfwvilNvss..tfvPlelsp 332
                   kq ++ r+l  +v     ++f+ l   +f +++   +   ++v + ++ ++  +++  +  ++a+++g+ + +++++++v   +s   + +P +ls 
  VIMSS1100263 751 KQQFIARWLTYIVIGVAQAVFVAL-GNIFLIKA---YIV-SPVALLLLAVFLSMVFMTIVYVLAAMFGNVGKGLAMIILVL-SISGggGNFPVVLSD 841
                   444444555544444333333332.23333333...444.344444444444444555566777778**********9875.5665589******** PP

       DUF3533 333 gFYrygyal.PlhniveilrvIffdtakgqlgrnlgiLlawvvvn 376
                   +F+++   l P+ + v++lr    ++++++l +n+ iL+++ vv 
  VIMSS1100263 842 KFFQFINPLlPFTYGVNLLREPTGGIYAPNLWHNFIILAIYAVVF 886
                   *****************************************9986 PP



Or compare VIMSS1100263 to CDD or PaperBLAST