PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS158582 to PF12051 (DUF3533)

VIMSS158582 has 927 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.5e-13   34.0  13.7      2e-12   32.7   0.0    2.9  3  VIMSS158582  


Domain annotation for each sequence (and alignments):
>> VIMSS158582  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.7   0.0     2e-12     2e-12       5     168 ..      24     173 ..      15     184 .. 0.76
   2 ?   -1.0  12.4     0.036     0.036     162     351 ..     687     868 ..     673     895 .. 0.76
   3 ?   -1.0   0.1     0.035     0.035     201     236 ..     875     906 ..     868     911 .. 0.79

  Alignments for each domain:
  == domain 1  score: 32.7 bits;  conditional E-value: 2e-12
      DUF3533   5 lavlilailslywGalyrrsdrlknlnvlvVneDeg..gseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgaivvken 100
                  + ++ l + s++  ++ ++  ++ +l+v+vVn D+   ++++t  vg+++ + +++++     +w++        s+ee e+ + ++ky++ ++++++
  VIMSS158582  24 ILFIPLLYASFFLKSVWDPYGKTGDLPVAVVNNDKPvdYNGQTMDVGDQLVTKLKSNK---ELDWNFL-------SKEEAEQGLKDGKYYMIVTIPKD 111
                  222234455666777778889***************8866666666665555555555...599*999.......69********************* PP

      DUF3533 101 ateklyaalsangassynstelleliyesgRdattvssyilpa.ltqleaaalakygsqllqqliqsls 168
                  ++++  + l  ++++     + +el y+++ + + + ++++++ ++ql++++ a++++++ + +  +++
  VIMSS158582 112 FSKNAASVL--DKDP-----KKMELSYKTNGSLNYLGQVVSEQgAKQLKSEVSAEVTKSYAEAIFDKIK 173
                  *********..3332.....4688999999999999999986537888888888998888887777766 PP

  == domain 2  score: -1.0 bits;  conditional E-value: 0.036
      DUF3533 162 qliqslsntaqaaqlsnallaspiafnsidlrPftd.gvalaplqvgliyliiltffqfaflgklhaemglsrklkfkqllvyrllisvvslfvlSlf 258
                  + +q++++t++++++ n ++a p +++ +++  +++ g alap  +   + + +    f+f+++++      +     ++++ +l +  v++  ++l+
  VIMSS158582 687 DGAQQVKDTKATDKTFN-MIAAPTKLAHNEYTHVSNyGHALAPYVLS--LALYVGALVFNFIMPIRRVS--MEGQPAYKWWLSKLSLGFVAAVAMALL 779
                  56677777777777544.78888888888887776624556664444..44445666677888887766..566667788999999999999999999 PP

      DUF3533 259 fslvslafqvdftvafGragFvvyWmitwlvmaavglanenvasilgppylpvwllfwvi.lNvsstfvPlelspgFYrygyal.Plhniveilr 351
                    ++ +a+++         + v +  +  ++++a  ++++ +a+ + +p+  ++++++++ l+ s +++P+ l   F+   + + P+ +++ + r
  VIMSS158582 780 EGGIMIALGLRP------DSIVEFFGTAIITALAYMFLIMLLAMTFDNPGRFIAMVLLIVqLAGSGGTFPMPLTGWFFNLIHPFlPMTYSIYAFR 868
                  999999999999......7899999999******************66655555554444289999*****************99*988776665 PP

  == domain 3  score: -1.0 bits;  conditional E-value: 0.035
      DUF3533 201 laplqvgliyliiltffqfaflgklhaemglsrklk 236
                  ++p +v+ + ++ilt++ +a++g l+ +m   ++lk
  VIMSS158582 875 MGP-NVYSMSMLILTIIMVACVGLLYLSM---SHLK 906
                  555.8999999999999999999999999...4444 PP



Or compare VIMSS158582 to CDD or PaperBLAST