PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS922160 to PF12051 (DUF3533)

VIMSS922160 has 949 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-15   42.6   6.7    6.3e-13   34.4   0.9    3.7  4  VIMSS922160  


Domain annotation for each sequence (and alignments):
>> VIMSS922160  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.4   0.9   6.3e-13   6.3e-13      22     155 ..      45     172 ..      21     208 .. 0.69
   2 ?   -3.0   1.7      0.14      0.14      48      77 ..     342     373 ..     326     459 .. 0.57
   3 ?   -2.0   1.0      0.07      0.07     124     176 ..     580     631 ..     563     654 .. 0.68
   4 !   20.5   0.6     1e-08     1e-08     174     358 ..     721     902 ..     690     920 .. 0.75

  Alignments for each domain:
  == domain 1  score: 34.4 bits;  conditional E-value: 6.3e-13
      DUF3533  22 rrsdrlknlnvlvVneDeg..gseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgaivvkenateklyaal...sanga 114
                  ++  ++kn++v+vVneD+g  +++ + +vg+ +++ +++       +w++v       s+++  +++  ++y++ai+++e +t +++  l   +++ +
  VIMSS922160  45 DPYGNTKNIKVAVVNEDKGdtVKDKNVNVGNKITNKLKKDD---NFDWQFV-------SRKKADHDLKMGDYYAAIYIPEKFTHQITGTLrknPQQAD 132
                  566789*************8755555555555555444444...4999999.......69***************************99952223344 PP

      DUF3533 115 ssynstelleliyesgRdattvssyilpaltqleaaalaky 155
                  ++y++++ l+ i  +  +    s+++++a +q+++++++++
  VIMSS922160 133 VEYKVNQKLNAIAPKMTN-AGTSAIVQKANEQFNETVTKAL 172
                  455555555555444433.2223333444444444444333 PP

  == domain 2  score: -3.0 bits;  conditional E-value: 0.14
      DUF3533  48 vgeavaqainettssslgt..wtvvnpsefke 77 
                   ++ +++++++ ++ss+g+  +  +++s++++
  VIMSS922160 342 ANNRLQENVETEQQSSKGSdsYSNIKTSQISN 373
                  33333333333333322221223333333322 PP

  == domain 3  score: -2.0 bits;  conditional E-value: 0.07
      DUF3533 124 eliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaql 176
                  e+i ++g+d     ++ lp ++q  ++a + + +++ +q+ qs+sn a    +
  VIMSS922160 580 ESILTTGKDRVETIQSALPVIEQRYMDAMS-IAQNYYPQFKQSVSNAASFIEN 631
                  678888888777777777777777776665.8888899999999988776653 PP

  == domain 4  score: 20.5 bits;  conditional E-value: 1e-08
      DUF3533 174 aqlsna.llaspiafnsidlrPftdgvalaplqvgliyliiltffqfaflgklhaemg.lsrklkfkqllvyrllisvvslfvlSlffslvs.lafqv 268
                   + + a ++a+pi++ + d+ P++d  + a++ ++ ++ i +    ++ l  + ++   l ++l  +++ + +  +  ++ ++ +l++s+   ++++ 
  VIMSS922160 721 LKKQ-AnVIANPINIDQKDIFPVKDY-GSASTPFYTALAIWVGALLLVSLLTTDNKHKsLEPHLTTREIYLGKSGLFYTLGIIQALIVSIGDmVILKA 816
                  2222.249***************996.566678*********99999999999999988999999999988777776666666666666555455555 PP

      DUF3533 269 dftvafGragFvvyWmit.wlvm.aavglanenvasilgppylpvwllfwvi.lNvsstfvPlelspgFYrygyal.PlhniveilrvIffdta 358
                  ++     +    v+W i  +++  ++++ +  +++s+lg+p+ +++++f+v  ++   +++P+++ p+F++  +   P+++++++lr    +  
  VIMSS922160 817 QV-----E---SVVWFIAiSVFSsLVFISIVYTLVSLLGNPGKAIAIIFLVLqIAGGGGTFPIQVTPEFFQVIHPYlPFSYSIDALREAVGGPV 902
                  55.....2...255554403333144555677888999*********99986344455***************9988*******9998766655 PP



Or compare VIMSS922160 to CDD or PaperBLAST