PaperBLAST – Find papers about a protein or its homologs

 

Align WP_011742615.1 to PF12051 (DUF3533)

WP_011742615.1 has 903 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.9e-12   30.8  11.7    2.7e-11   29.0   2.3    3.3  4  WP_011742615.1  


Domain annotation for each sequence (and alignments):
>> WP_011742615.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.0   2.3   2.7e-11   2.7e-11      21     173 ..      44     183 ..      21     232 .. 0.68
   2 ?   -5.0   2.8       0.6       0.6     100     175 ..     289     361 ..     283     399 .. 0.48
   3 !   16.0   2.1   2.5e-07   2.5e-07     124     351 ..     454     674 ..     427     684 .. 0.74
   4 ?   -8.0   5.6         1         1     278     315 ..     774     805 ..     770     815 .. 0.49

  Alignments for each domain:
  == domain 1  score: 29.0 bits;  conditional E-value: 2.7e-11
         DUF3533  21 yrrsdrlknlnvlvVneDeggseltpvvg..eavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgaivvkenateklyaalsang 113
                      ++  ++ n++v+v neD+g  +++ +vg  +a +q +n++++++   w++v+       +++  e v  +ky++aiv +e+++++l   ++ +g
  WP_011742615.1  44 WDPYANTGNIQVAVANEDKG--TTSTLVGhlDAGQQTVNQLKKNHQLGWRFVP-------KQQAIEGVESGKYYAAIVLPEDFSSRLIGTVTGKG 129
                     556667889***********..66666663378999999999998888****7.......788999*************************8888 PP

         DUF3533 114 assynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqa 173
                     +    ++  ++ +y + +      ++  + +t+++++ + +++s++   +++++++ a  
  WP_011742615.1 130 DR---PS--IT-YYINEKLNAIAPKITDTGATTIDEQINTTFVSSVADAVAKEVKEAAGE 183
                     73...33..33.333333334445555555555666666566555555555555544332 PP

  == domain 2  score: -5.0 bits;  conditional E-value: 0.6
         DUF3533 100 nateklyaalsangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaq 175
                     nat ++ + l++++++  +++++++ + ++    ++v   + +al++ + + +++  ++l  ql+++ ++ +  +q
  WP_011742615.1 289 NATGTVLSGLNTTQDALDQVSSTMHHVNTTT---GNVLDDVEKALQASQLDPNSQTYKDLSAQLAEARKQLTFQQQ 361
                     4444444444333333222333333322222...344555555555555555555555554444444333333332 PP

  == domain 3  score: 16.0 bits;  conditional E-value: 2.5e-07
         DUF3533 124 eliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqlsnallaspiafnsidlrPftdgvalaplqvgliyliiltffq 218
                     + + ++    +t  ++++++l+++ ++++a  +s ++qql q+l   a    +    + +p+ +    l P+++  + a++ ++  + + + +f 
  WP_011742615.1 454 TQTNTTIAGTQTQLANLAKQLNTTRTDVAALSSSAMFQQLSQALGLDASEVGS---FVGEPVHLDEQVLYPVKNY-GSAVTPFYTNLALWVGGFV 544
                     44444444445556677788888888888888888888888888865554443...9999999999999999874.556667************* PP

         DUF3533 219 faflgklhaemglsrkl...kfkqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvyWmitwlvmaavglanenvasilgppylp 310
                     ++++ kl  +    +k+    ++q  + r+l+ v++ f  +++ ++  la++++        ++ ++ ++  ++ ++   ++  +a+++   + +
  WP_011742615.1 545 LVAIYKLEVDRD--EKIrmyTPRQGYMGRWLLFVTVGFLQAIIATIGDLALGIQC------EHPFLFILAGIFASFVYVNIIYALAVAFRHIGKA 631
                     ********9995..44433488999999***************************......4455544555555555555555555555555555 PP

         DUF3533 311 vwllfwvi.lNvsstfvPlelspgFYrygyal.Plhniveilr 351
                     v+ ++ +i +  + +++P+e++p+F+r +  + P+ + ++++r
  WP_011742615.1 632 VAVILVIIqIPGAAGLYPIEMMPEFFRRLKPFlPFTYGINAMR 674
                     55544443155566*****************99*999988887 PP

  == domain 4  score: -8.0 bits;  conditional E-value: 1
         DUF3533 278 gFvvyWmitwlvmaavglanenvasilgppylpvwllf 315
                     gF+ + ++ ++++++++++ + +a++lg      w+++
  WP_011742615.1 774 GFLALAVLPFVFLLLLFITRMKLAMLLG------WIIS 805
                     4444444455555555555555555553......3333 PP



Or compare WP_011742615.1 to CDD or PaperBLAST