PaperBLAST – Find papers about a protein or its homologs

 

Align WP_039196678.1 to PF12051 (DUF3533)

WP_039196678.1 has 915 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.9e-13   34.5  14.0    7.1e-11   27.7   1.3    4.7  5  WP_039196678.1  


Domain annotation for each sequence (and alignments):
>> WP_039196678.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.7   1.3   7.1e-11   7.1e-11      26     177 ..      49     187 ..      38     204 .. 0.81
   2 !    1.0   4.4    0.0089    0.0089     102     203 ..     170     273 ..     169     275 .. 0.76
   3 ?   -3.4   9.2       0.2       0.2      99     200 ..     274     371 ..     269     379 .. 0.77
   4 !   21.0   5.5   7.5e-09   7.5e-09     110     367 ..     422     680 ..     412     691 .. 0.77
   5 ?   -3.4   2.7      0.19      0.19     256     302 ..     769     814 ..     765     821 .. 0.80

  Alignments for each domain:
  == domain 1  score: 27.7 bits;  conditional E-value: 7.1e-11
         DUF3533  26 rlknlnvlvVneDeggseltpvvgeavaqainettss.slgtwtvvnpsefkeseeeveelvhkekywgaivvkenateklyaalsangassyns 119
                     +++ ++v+v n D+g +++  + + ++ ++i++t ++     w+++        ++e  e+v  ++ ++ai++++n++e+l + ++++++   ++
  WP_039196678.1  49 NTQGIKVAVANVDTG-TDNALLGKMNLGDQIEDTLKDnDQLGWEFM-------GKAEAMEAVQSGDCYAAIIIPSNFSEDLANVVTESKN---RP 132
                     6677899999****9.666677777888888888877755569999.......799*****************************55555...56 PP

         DUF3533 120 telleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqls 177
                     t  le+++++  +     ++  + +t+++++++++++s++ + l++++++ + + + +
  WP_039196678.1 133 T--LEYYVNEKSS-PISPKITDQGATTVDRTVNNTFVSTVSEVLTKAVNSANGTINGK 187
                     6..9999998876.67788889999**************9999999999887766544 PP

  == domain 2  score: 1.0 bits;  conditional E-value: 0.0089
         DUF3533 102 teklyaal.sangassynstelleliyesgRdattvssyilpaltqleaaala.kygsqllqqliqslsntaqaaqlsna...llaspiafnsid 191
                     +e l++a+ sang+   ++++ ++ ++++  + +   s i +++++l+a++++  +++q  +q++++++  a++a    +   + +++i ++++ 
  WP_039196678.1 170 SEVLTKAVnSANGTINGKTNSFVNETTAELDKTQKNVSLIRSTIEDLDAQLANvPQQTQSARQAMNDVQLAAASAG---KglaNTSTAIGTAQNG 261
                     6778999989999988888888877777777677777899999999999999944444444566666666666666...344599999******* PP

         DUF3533 192 lrPftdgvalap 203
                     l+ ft  +++a+
  WP_039196678.1 262 LNTFTANANTAL 273
                     ****99999876 PP

  == domain 3  score: -3.4 bits;  conditional E-value: 0.2
         DUF3533  99 enateklyaalsangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqlsnallaspiafnsidlr 193
                     en +  +++a+s++++s  ++t ++++   ++++a +  ++++++  ql ++++    ++  q++i++l++t+++a        +++++ s++ +
  WP_039196678.1 274 ENGSGLISQATSDTTTSINKVTTAVSSASGTAQQAVSNMQSVTDSNAQLIEKLKGVSDNTQYQDIIKKLEDTNNTAA----GTLNDLKTLSENTQ 364
                     577778889997777777778899999999999998888888888888888888878888888*******9999998....45566666666666 PP

         DUF3533 194 Pftdgva 200
                      ++d+va
  WP_039196678.1 365 STSDSVA 371
                     6666665 PP

  == domain 4  score: 21.0 bits;  conditional E-value: 7.5e-09
         DUF3533 110 sangassynstelleliyesgRdattvssyilpaltqleaaala..kygsqllq.qliqslsntaqaaqlsna.llaspiafnsidlrPftd.gv 199
                     + +++  ++++++l+  y+ + d  t  ++  ++l+q+e+++    +  + l + +++++l+  +  ++ + a  ++sp  + + ++ P+++ g+
  WP_039196678.1 422 TSQNTIVTQTSAVLDQLYQVANDTRTTLQNTDKQLEQVENKLITvsTDLKALGSvDMLKNLTGDSSLDTEKIAsFMQSPTVIDTKNVYPINSyGS 516
                     66677778888999999999999999999999999999998766324455666677888888777777755558999999999999999987356 PP

         DUF3533 200 alaplqvgliyliiltffqfaflgklhaemg..lsrklkfkqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvyWmitwlvmaa 292
                     ++ap  +   + + +  f f++++k+  + +      l  ++  + r+++ +++    + ++++  l+++v++    + + F+++++it+lv + 
  WP_039196678.1 517 GMAP--LMTNLALWVGAFAFVVIFKVEVDDEglEDLDLTASEKYFARYMLLGIMGAAQGTITTIGDLLLGVQT---VNAPLFALTGIITSLVYLS 606
                     6666..5566666666666666666666555446777788888899***99999999999999999****999...66789************** PP

         DUF3533 293 vglanenvasilgppylpvwllfwvilNvsstfvPlelspgFYrygyal.PlhniveilrvIffdtakgqlgrnlg 367
                     + +a+ +  + +g  +  v+l + v +  +s+++P+e++p+F+r  y + P+++++++ r  + + + g   + +g
  WP_039196678.1 607 ITFALSTTFMHIGKGLC-VAL-IIVQIPGASGLYPIEMMPKFFRMVYPFvPFSYSIDAFRETIAGFYDGHWLKSIG 680
                     **********9997654.444.346667899****************************98755555544444444 PP

  == domain 5  score: -3.4 bits;  conditional E-value: 0.19
         DUF3533 256 SlffslvslafqvdftvafGragFvvyWmitwlvmaavglanenvas 302
                     + f++ v+l++   f +++ ++  + +W+i +l ++ + +++e +  
  WP_039196678.1 769 AGFIVPVILVLIFSF-TNGEKSVVLATWIIWVLLIIGFLMVIEYMRF 814
                     567777788888888.7788889999999999999999999998865 PP



Or compare WP_039196678.1 to CDD or PaperBLAST