PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001838433.2 to PF12051 (DUF3533)

XP_001838433.2 has 447 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.8e-91  291.5   8.5    6.1e-91  291.2   8.5    1.0  1  XP_001838433.2  


Domain annotation for each sequence (and alignments):
>> XP_001838433.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  291.2   8.5   6.1e-91   6.1e-91       3     377 ..      49     416 ..      48     417 .. 0.96

  Alignments for each domain:
  == domain 1  score: 291.2 bits;  conditional E-value: 6.1e-91
         DUF3533   3 lllavlilailslywGalyrrsdrlknlnvlvVneDeggseltpvvgeavaqainettss.slgtwtvvnpsefkeseeeveelvhkekywgaiv 96 
                     l++av+i++il +ywGaly+    ++nl+ +vV++D++      ++g+++ qa+ +++++ +++tw  ++ s+f+   e++ ++v +e++w+ai 
  XP_001838433.2  49 LFVAVMIFTILPIYWGALYKVP--VRNLEGWVVDFDGD------MLGQTISQALVQIAAQrGRITWIPKPASDFSRGLENLAQDVRDERIWAAIA 135
                     789****************975..78************......********999999999********************************** PP

         DUF3533  97 vkenateklyaalsangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqlsna...llaspiafn 188
                     +++ +t++l++++ +  +++yn +++++ +  ++R++++++  i p+++   ++   ++  ++++ + + ls ta   + s++   +l  p+ ++
  XP_001838433.2 136 ISPSSTTTLFSSI-QIPNPAYNGSNVITAYAVEARNEQAYRGLIRPSIDLALTTISHQLALETTKRASRMLSPTALQVL-SQEspqTLVAPVGYT 228
                     *************.**************************************************988888886554444.444489********* PP

         DUF3533 189 sidlrPftdgvalaplqvgliyliiltffqfaflgklhaemglsrklkfkqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvyW 283
                     + +l Pf+++va a++ vg+ + + l+ f +++ +++++  g   +l+ ++ll++r+++    +f++Sl+++l++lafq+d+t+++G+agFvv+W
  XP_001838433.2 229 IHNLIPFDQPVASAATFVGMLLQLALSAFVVMVAFGARTLSGYEHSLSTTRLLILRFVSIFAGFFFISLMYCLLNLAFQLDVTRKYGHAGFVVFW 323
                     ***************************************9999**************************************************** PP

         DUF3533 284 mitwlvmaavglanenvasilgppylpvwllfwvilNvsstfvPlelspgFYrygyalPlhniveilrvIffdtakgqlgrnlgiLlawvvvnt 377
                     m+++l  +a gla+e++++++gp+++p++ll+w+i+N+s t++P+e+ p+FYrygy +P+++++++lr+I f+t+  ++gr  giL+aw+ ++ 
  XP_001838433.2 324 MVNFLGTLATGLAIESILILFGPKGVPFFLLLWIIVNLSATLFPIEVLPAFYRYGYGVPFYSLTKALRTIVFGTKD-RMGRTCGILIAWISISC 416
                     ****************************************************************************.*************9875 PP



Or compare XP_001838433.2 to CDD or PaperBLAST