PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001886505.1 to PF12051 (DUF3533)

XP_001886505.1 has 453 amino acids

Query:       DUF3533  [M=376]
Accession:   PF12051.11
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      2e-90  289.5  18.1    2.4e-90  289.2  18.1    1.1  1  XP_001886505.1  


Domain annotation for each sequence (and alignments):
>> XP_001886505.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  289.2  18.1   2.4e-90   2.4e-90       4     375 ..      62     424 ..      59     425 .. 0.97

  Alignments for each domain:
  == domain 1  score: 289.2 bits;  conditional E-value: 2.4e-90
         DUF3533   4 llavlilailsiywGalyrrsdrlknlnvlvVneDeggselepvvgeavakiiketassslgtwkvinssefkesekeveelvhkekywgalvvk 98 
                     l++vli++++siywG+l++    ++nl+ +vV++D+g      +vg +va  + ++   s++tw vi+ s+     +e+  lv +e++w a+ + 
  XP_001886505.1  62 LIVVLIFSVFSIYWGSLWKIP--AHNLHGWVVDFDGG------MVGHQVARSLGSNVGPSKVTWSVIPASQVAGGLDELAILVREEHTWVAVAIH 148
                     689***************976..79************......**************99************************************ PP

         DUF3533  99 enatealyaalasangassynstellelvyesgrdptnvksyilpiltqleaaalskyskellqslikslsnssqaalla.llasplafnsiDlr 192
                     ++a+++l aal  +  +s+y+ +e+++++  ++r++++ +++i+p++++  +++ +++  ++ +s++++ + s+ ++++  ++++p+++++++l 
  XP_001886505.1 149 PEASAKLNAAL--TIPNSTYDGSEAVTVYAVEARNENAFRNIIQPSVESSLTVISASFALQISRSVANASTLSTLMSTSPqTITTPISYTFNNLV 241
                     ***********..888999********************************************999888888777777558************** PP

         DUF3533 193 pftdavalaplqvgliyliiltffqlaflgklhaqml.srklkfkqllvyrllisvislfvlSLffslvslafqvdftvafGragFvvyWmitwl 286
                     pf+ +va+a++ vgl y +il+ff +++   ++   +  ++l++++l+++r+++s  ++f+lSLf+sl+++af+ ++ ++fG+agF+++Wm++++
  XP_001886505.1 242 PFDVPVATAATFVGLLYQLILSFFVVMITLTAREISGlNKSLSLRNLILLRFASSFGAYFFLSLFYSLLNAAFHLPMSRKFGHAGFILFWMLSYV 336
                     ********************************999999********************************************************* PP

         DUF3533 287 vmlavglanenvasilgppylpvwllfwvilNvsttfvPlelspgFYrygyalPlhniveilrvIffdtskgqlgrnlGiLfaWvvvnt 375
                      ml vgla+e ++++l ++++p+++++w+i+N+s+ ++P+e++p+ + ygya P++ni +++r+I+f+t++ + g  +GiL+ W++++ 
  XP_001886505.1 337 GMLSVGLALESLVTLLTVKFIPFFMITWIITNISVCIYPIEVLPRIFHYGYAAPFYNISRAMRTIIFGTKN-EVGMHFGILLVWIAISC 424
                     ***********************************************************************.**************986 PP



Or compare XP_001886505.1 to CDD or PaperBLAST