PaperBLAST – Find papers about a protein or its homologs

 

Align XP_002372676.1 to PF12051 (DUF3533)

XP_002372676.1 has 475 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.3e-96  308.5  10.1    4.7e-96  308.0  10.1    1.2  1  XP_002372676.1  


Domain annotation for each sequence (and alignments):
>> XP_002372676.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  308.0  10.1   4.7e-96   4.7e-96       4     374 ..      30     385 ..      27     389 .. 0.97

  Alignments for each domain:
  == domain 1  score: 308.0 bits;  conditional E-value: 4.7e-96
         DUF3533   4 llavlilailslywGalyrrsdrlknlnvlvVneDeggseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgaivvk 98 
                     ll++l+l+ +++++G++yr+ +r+++l++l+V++D++      vvg++v +a+  ++s+++ ++ + + se++ ++++v+++v+k++ywga++  
  XP_002372676.1  30 LLQLLFLGNMCYLYGTQYRDGTRFHKLKMLYVDYDGD------VVGQSVVDAYGMLSSDEFPSLIQSPASEYP-TPKDVKTAVCKGDYWGAVYAH 117
                     89***********************************......******************************.********************* PP

         DUF3533  99 enateklyaal.sangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqlsnallaspiafnsidl 192
                     ++a+++l+aal + ng+    +t  l++i++ +R++   +s+i +++++l ++ +++y  ++ +++++++  +++ a+l+  +  +pi+ n i++
  XP_002372676.1 118 PGASSNLSAALaTGNGN----RT-SLTYIWNGARYPAFSQSAIYSSIMSLVQVTKSAYYARNASNVLATAPLSKNPASLQ--AFLDPIQANEINI 205
                     ***********555555....55.89**************************************9999999999999874..89*********** PP

         DUF3533 193 rPftdgvalaplqvgliyliiltffqfaflgklhaemglsrklkfkqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvyWmitw 287
                     + +++g+++ +++v +++ ii++ff++++l+++ a+++l++kl +++  ++rl++s+ ++f++Sl++ ++++a++  + v+ ++  Fv+ Wm+ w
  XP_002372676.1 206 KVTEQGSRVLYNTVSMVMPIIQQFFFMMALNGISAQFHLYTKLGPTRNGLLRLCVSLAYTFIGSLCMAGYIWAYRESWDVNSNQ--FVLSWMSVW 298
                     ******************************************************************************999999..********* PP

         DUF3533 288 lvmaavglanenvasilgppylpvwllfwvilNvsstfvPlelspgFYrygyalPlhniveilrvIffdtakgqlgrnlgiLlawvv 374
                     l+m+ ++l+ +++++++++++lp+ +l+w i+Nv+s++ P+elspgFYr+gyalP+h+++++l +I++d+++ ql+r+l+i++ w++
  XP_002372676.1 299 LYMHINFLIVDILTAFIPMQFLPFCILTWAIINVASSISPFELSPGFYRWGYALPAHELYQVLVQIWSDGCEDQLYRALPIMFSWWI 385
                     *************************************************************************************97 PP



Or compare XP_002372676.1 to CDD or PaperBLAST