PaperBLAST – Find papers about a protein or its homologs

 

Align XP_002381476.1 to PF12051 (DUF3533)

XP_002381476.1 has 510 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   2.5e-109  351.7  12.0   3.6e-109  351.2  12.0    1.2  1  XP_002381476.1  


Domain annotation for each sequence (and alignments):
>> XP_002381476.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  351.2  12.0  3.6e-109  3.6e-109       1     377 [.      34     399 ..      34     400 .. 0.99

  Alignments for each domain:
  == domain 1  score: 351.2 bits;  conditional E-value: 3.6e-109
         DUF3533   1 nvlllavlilailslywGalyrrsdrlknlnvlvVneDeggseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgai 95 
                     n+++l++l+l+++++++G+l++++++++nl++++V++D+g      +vg+a+++a+++++  ++ t+   + s ++ ++  v+++v++ +ywg +
  XP_002381476.1  34 NFIVLQLLFLGLFCYLFGSLFQQTTHIHNLHIVYVDYDGG------AVGSAIRTAYEQLKGPGFPTLSEQSVSAYS-QPSTVRSAVCNIDYWGGL 121
                     6899************************************......**************9999999999999**9.****************** PP

         DUF3533  96 vvkenateklyaal.sangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqlsnallaspiafns 189
                     + +++a+ +l aa    + a+syn +++l+l+++++R+ t+v+s+i++++++l++aa+ +y + +  q++++l++t++aa++   +l++p++++s
  XP_002381476.1 122 YTSADASIRLAAAFgGGSAAASYNNSDVLTLVWNEARYSTVVDSAISTNMQTLSEAARVAYFKINGMQALGDLNSTDPAAIA---ALTNPWTLAS 213
                     *********************************************************************************6...9********* PP

         DUF3533 190 idlrPftdgvalaplqvgliyliiltffqfaflgklhaemglsrklkfkqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvyWm 284
                     i+++P+t+g++l+++++++i+++i++ff+++++++l+++++l+ ++  ++++ +r lis+++++ +Sl+++++++af+  ++v++G+  F+++Wm
  XP_002381476.1 214 INIQPTTQGSRLVYNTLVIILILIQEFFYLGYINGLYQQFQLYVSIAAPRIATVRQLISGLYTLSGSLCTTGAIWAFRHGWHVNGGQ--FALTWM 306
                     ***************************************************************************************..****** PP

         DUF3533 285 itwlvmaavglanenvasilgppylpvwllfwvilNvsstfvPlelspgFYrygyalPlhniveilrvIffdtakgqlgrnlgiLlawvvvnt 377
                     ++wl+++ ++l++++++++l+pp++p++l++wv+lNv+s+++P+el+pgFY++gyalP+h+i+++l +I++d++++ql ++l++L+a+ v+++
  XP_002381476.1 307 ALWLFAHSNFLVLDVFTVWLPPPVVPMALISWVVLNVTSILLPFELAPGFYQWGYALPAHSIFQVLVDIWSDGCNPQLDYALPVLFAYEVIGL 399
                     *****************************************************************************************9975 PP



Or compare XP_002381476.1 to CDD or PaperBLAST