PaperBLAST – Find papers about a protein or its homologs

 

Align XP_003031713.1 to PF12051 (DUF3533)

XP_003031713.1 has 391 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.8e-96  308.3  17.8    4.3e-96  308.1  17.8    1.0  1  XP_003031713.1  


Domain annotation for each sequence (and alignments):
>> XP_003031713.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  308.1  17.8   4.3e-96   4.3e-96       3     377 ..      14     378 ..      12     379 .. 0.96

  Alignments for each domain:
  == domain 1  score: 308.1 bits;  conditional E-value: 4.3e-96
         DUF3533   3 lllavlilailslywGalyrrsdrlknlnvlvVneDeggseltpvvgeavaqainettss.slgtwtvvnpsefkeseeeveelvhkekywgaiv 96 
                     +++a++i++i+s+ywGal +  +  ++l+ +v+++D++       +g++v +a+ + ++  s++ w   + +ef++   +v +++ +e++w a++
  XP_003031713.1  14 VMVACIIFGIFSIYWGALWKIPT--HQLRGWVIDFDGD------RIGSTVSEALVQSSAGgSKVHWISRSANEFPNGVSDVADAILDEQAWIAVT 100
                     799****************9875..79***********......99999999999888888********************************** PP

         DUF3533  97 vkenateklyaalsangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaqlsnallaspiafnsid 191
                     ++  at++l++a+ a+ ++syn +++l+ +  ++R++++++++++p l+++ ++   ++  q+  q+++s + ++   + + +l+ +p+ ++ ++
  XP_003031713.1 101 INDAATSNLQRAI-ASVNASYNGSSALTAYGVESRNENAYRTILNPVLQSTMQQISTQFARQTAAQIANSSNMSQILGS-APQLIVQPVFYTLVN 193
                     *************.************************************************99998888776554444.555************ PP

         DUF3533 192 lrPftdgvalaplqvgliyliiltffqfaflgklhaemglsrklkfkqllvyrllisvvslfvlSlffslvslafqvdftvafGragFvvyWmit 286
                     +rPf+ +va a++ vg iy iil+ff +++ g+++ + gl rkl   +l+ +r++ s v++f+lSl++sl+slafqv+f +++ +agFv++Wmi+
  XP_003031713.1 194 IRPFDVPVASAVTFVGCIYQIILAFFVVVIAGGAREASGLERKLTTLSLIHVRMVTSFVAYFILSLLYSLLSLAFQVPFDRKYDHAGFVIFWMIN 288
                     *********************************************************************************************** PP

         DUF3533 287 wlvmaavglanenvasilgppylpvwllfwvilNvsstfvPlelspgFYrygyalPlhniveilrvIffdtakgqlgrnlgiLlawvvvnt 377
                     ++ m+a+gla+e ++++l  +++p++l++w+i Nvs++f+P+e+ p+++rygy +P++ni  ++r+I+f++++ +lg+n+gi++aw +v+ 
  XP_003031713.1 289 YVGMLALGLALEAMITLLTVRLIPFFLILWIISNVSVAFMPIEVLPAVFRYGYGFPVYNISHAVRSIIFGAKN-NLGLNFGIVIAWAAVSC 378
                     *************************************************************************.*************9986 PP



Or compare XP_003031713.1 to CDD or PaperBLAST