WP_003264554.1 has 85 amino acids
Query: DUF3567 [M=89]
Accession: PF12091.12
Description: Protein of unknown function (DUF3567)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-40 123.2 0.1 2.3e-40 123.0 0.1 1.0 1 WP_003264554.1
Domain annotation for each sequence (and alignments):
>> WP_003264554.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 123.0 0.1 2.3e-40 2.3e-40 1 89 [] 1 85 [] 1 85 [] 0.99
Alignments for each domain:
== domain 1 score: 123.0 bits; conditional E-value: 2.3e-40
DUF3567 1 mqmlYdsdsfvvveleadaeeealaekeargGyEivDKrakkeiyldGslAelFrkkvkaliekepseeevddfldkyaslaqqpvvlH 89
mqm+Y+sd+++vve+ ad ++++l + gGyEivDK+ k+ei+l G+lAe Fr++vk+li++ep+ eevd fl+k++++++qpvv+H
WP_003264554.1 1 MQMIYNSDNYCVVEFGADGQHATL----SAGGYEIVDKNLKREIFLGGELAEHFREDVKRLIASEPTVEEVDAFLGKFDTVMMQPVVMH 85
9***********************....99**********************************************************9 PP
Or compare WP_003264554.1 to CDD or PaperBLAST