G3GVG4 has 912 amino acids
Query: bMERB_dom [M=134] Accession: PF12130.12 Description: Bivalent Mical/EHBP Rab binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-45 138.8 20.2 1.1e-44 137.9 20.2 1.4 1 G3GVG4 Domain annotation for each sequence (and alignments): >> G3GVG4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 137.9 20.2 1.1e-44 1.1e-44 2 133 .. 750 880 .. 749 881 .. 0.98 Alignments for each domain: == domain 1 score: 137.9 bits; conditional E-value: 1.1e-44 bMERB_dom 2 qreleeieeelkeleergvelEkkLReseegeeeeeelleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrellekedsekteedkkreee 101 qr+l++ie +l++le rgvelEk+LR +eg+ e++l+ +wf L++ek+ l+r eseL++ +k+q+Lee+q +l+ elr+l++k++ k+++d++re+e G3GVG4 750 QRQLQDIESQLDALELRGVELEKRLR-AAEGDAAEDSLMVDWFLLIHEKQLLLRLESELMYKSKDQRLEERQLDLQDELRRLIDKPEGLKSPRDRQREQE 848 9*************************.5899********************************************************************* PP bMERB_dom 102 lleelveiVekRdelvesleedrlreeeedee 133 ll+++v++V++R+++v++l+edrlre+eed++ G3GVG4 849 LLSQYVNTVNDRSDIVDFLDEDRLREQEEDQM 880 ******************************97 PP
Or compare G3GVG4 to CDD or PaperBLAST