NP_001299826.1 has 783 amino acids
Query: bMERB_dom [M=134] Accession: PF12130.12 Description: Bivalent Mical/EHBP Rab binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-48 150.3 22.9 1.7e-48 150.3 22.9 2.1 2 NP_001299826.1 Domain annotation for each sequence (and alignments): >> NP_001299826.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.6 0.1 0.1 86 109 .. 414 437 .. 403 443 .. 0.66 2 ! 150.3 22.9 1.7e-48 1.7e-48 1 134 [] 613 749 .. 613 749 .. 0.94 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.1 bMERB_dom 86 kedsekteedkkreeelleelvei 109 +e+++ +e++k++ + ++ ++v++ NP_001299826.1 414 TEKEKENEKEKEKAKAVIGKMVKV 437 333444455666667888888876 PP == domain 2 score: 150.3 bits; conditional E-value: 1.7e-48 bMERB_dom 1 iqreleeieeelkeleergvelEkkLReseegeeeeee....lleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrellekedsek 91 iq+el+eie +++ele++gvelEk+LR+++e+ ee+ + l+ +wf+L+++k+ +rreseLv++a++q+Leeeq +++ elr+l+ek+d+ k NP_001299826.1 613 IQKELKEIEMNMNELEKKGVELEKQLRQCDEDGEED-AlmndLMVDWFTLIRNKQVYMRRESELVYIARTQDLEEEQPSVDAELRRLMEKPDHLK 706 89*************************766644444.3466699*************************************************** PP bMERB_dom 92 teedkkreeelleelveiVekRdelvesleedrlreeeedeel 134 t +d+kreeel+++lveiV++R+++ve l+edrlreeeede+l NP_001299826.1 707 TLWDRKREEELMAKLVEIVNDRNAIVEGLDEDRLREEEEDEQL 749 ****************************************985 PP
Or compare NP_001299826.1 to CDD or PaperBLAST