NP_505468.1 has 901 amino acids
Query: bMERB_dom [M=134] Accession: PF12130.12 Description: Bivalent Mical/EHBP Rab binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-25 73.7 8.4 7.8e-25 73.7 8.4 2.1 2 NP_505468.1 Domain annotation for each sequence (and alignments): >> NP_505468.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.7 0.23 0.23 65 101 .. 551 587 .. 548 594 .. 0.71 2 ! 73.7 8.4 7.8e-25 7.8e-25 2 133 .. 740 868 .. 739 869 .. 0.97 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.23 bMERB_dom 65 keqeLeeeqaeleqelrellekedsekteedkkreee 101 k eL ++ ++l ++ + ++++s+k +++++r ee NP_505468.1 551 KRDELRQRARDLIEKSTTPAATPNSRKASDEERRREE 587 5667888888888888888888888887666666555 PP == domain 2 score: 73.7 bits; conditional E-value: 7.8e-25 bMERB_dom 2 qreleeieeelkeleergvelEkkLReseegeeeeeelleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrellekedsekteedkkre 99 ++el +i+e++++++++++++++k+Re+e g++eee l+ +++eL+ne+n+lv+r+++++i+++ ++ ++e+++l ++++e+ +d +++e+k+++ NP_505468.1 740 ANELVRIDERISDITAQADVIQDKIRETEVGSSEEEMLTASYLELTNERNTLVHRQEYYNIIETIRQVTSEIDQLGKQINEVP--DDFPRSDENKTAT 835 589*****************************************************************************996..679********** PP bMERB_dom 100 eelleelveiVekRdelvesleedrlreeeedee 133 ++l+e++ + ++ +++lv++l +++ e+eed++ NP_505468.1 836 DKLIEQYSDAMKTKSNLVQKLFATED-EIEEDSD 868 *************************9.9999975 PP
Or compare NP_505468.1 to CDD or PaperBLAST