VIMSS188972 has 338 amino acids
Query: DUF5981 [M=95]
Accession: PF12225.12
Description: Methylene-tetrahydrofolate reductase C terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.4e-14 38.6 0.0 5.2e-14 38.0 0.0 1.2 1 VIMSS188972
Domain annotation for each sequence (and alignments):
>> VIMSS188972
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 38.0 0.0 5.2e-14 5.2e-14 41 78 .. 3 39 .. 1 51 [. 0.88
Alignments for each domain:
== domain 1 score: 38.0 bits; conditional E-value: 5.2e-14
DUF5981 41 rCpksllnGpCgGskngkCevkpekeCawvliyerlkk 78
Cpk+llnGpCgG+ +gkCev+ ++ C w +e+ +
VIMSS188972 3 GCPKDLLNGPCGGALDGKCEVN-SNLCPWYSLMEKFEL 39
6*********************.789*****9998765 PP
Or compare VIMSS188972 to CDD or PaperBLAST