WP_021167187.1 has 222 amino acids
Query: DUF5981 [M=95]
Accession: PF12225.12
Description: Methylene-tetrahydrofolate reductase C terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-40 122.6 2.6 2.2e-40 122.6 2.6 1.9 2 WP_021167187.1
Domain annotation for each sequence (and alignments):
>> WP_021167187.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -0.7 0.2 0.065 0.065 13 26 .. 18 31 .. 7 38 .. 0.56
2 ! 122.6 2.6 2.2e-40 2.2e-40 2 95 .] 112 205 .. 111 205 .. 0.98
Alignments for each domain:
== domain 1 score: -0.7 bits; conditional E-value: 0.065
DUF5981 13 eevkvleekCkaCg 26
+++kvl C C
WP_021167187.1 18 NAKKVLVAGCGGCV 31
44444444555553 PP
== domain 2 score: 122.6 bits; conditional E-value: 2.2e-40
DUF5981 2 pavntlflgveeevkvleekCkaCgeCvlaetggiCpvtrCpksllnGpCgGskngkCevkpekeCawvliyerlkklgrleklekivppkdws 95
p++nt+f+g+ e++++ee+C CgeCvla+tgg+Cp+ rC+ksllnGpCgGs+ng Cev+++++C w+liy+rlk +grl+ ++++ p+kdws
WP_021167187.1 112 PGQNTKFAGAAVEHGIWEERCMLCGECVLAKTGGVCPIIRCSKSLLNGPCGGSQNGVCEVSKDTPCGWQLIYDRLKGQGRLDMMTEVLPAKDWS 205
789******************************************************************************************6 PP
Or compare WP_021167187.1 to CDD or PaperBLAST