NP_002102.4 has 3144 amino acids
Query: DUF3652 [M=41]
Accession: PF12372.11
Description: Huntingtin protein region
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-25 75.6 0.6 4.5e-25 73.6 0.6 2.2 1 NP_002102.4
Domain annotation for each sequence (and alignments):
>> NP_002102.4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.6 0.6 4.5e-25 4.5e-25 1 41 [] 1515 1555 .. 1515 1555 .. 0.98
Alignments for each domain:
== domain 1 score: 73.6 bits; conditional E-value: 4.5e-25
DUF3652 1 allqiPrIiqLcdglmASgqpavrheipalrpilqDtffyr 41
++++iP+IiqLcdg+mASg++av+h+ipal+pi++D+f++r
NP_002102.4 1515 QIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLR 1555
69*************************************98 PP
Or compare NP_002102.4 to CDD or PaperBLAST