NP_077333.2 has 3120 amino acids
Query: DUF3652 [M=41]
Accession: PF12372.11
Description: Huntingtin protein region
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.2e-26 75.8 0.6 4.5e-25 73.6 0.6 2.4 1 NP_077333.2
Domain annotation for each sequence (and alignments):
>> NP_077333.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.6 0.6 4.5e-25 4.5e-25 1 41 [] 1494 1534 .. 1494 1534 .. 0.98
Alignments for each domain:
== domain 1 score: 73.6 bits; conditional E-value: 4.5e-25
DUF3652 1 allqiPrIiqLcdglmASgqpavrheipalrpilqDtffyr 41
++++iP+IiqLcdg+mASg++av+h+ipal+pi++D+f++r
NP_077333.2 1494 QIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLR 1534
69*************************************98 PP
Or compare NP_077333.2 to CDD or PaperBLAST