NP_001073922.2 has 2190 amino acids
Query: DUF3677 [M=81] Accession: PF12432.12 Description: Protein of unknown function (DUF3677) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-39 118.4 2.5 2.7e-38 116.5 2.5 2.2 1 NP_001073922.2 Domain annotation for each sequence (and alignments): >> NP_001073922.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 116.5 2.5 2.7e-38 2.7e-38 1 81 [] 350 430 .. 350 430 .. 0.99 Alignments for each domain: == domain 1 score: 116.5 bits; conditional E-value: 2.7e-38 DUF3677 1 llklLsslcgipevrllvasrleiwlqnpKLvreaqelLlslcvncntssekdsevidaLvklrlKtkalinlftacikel 81 ll+lL+s+cg++evrll++++le+wlqnpKL+r+aq+lL+s+c+ncnt+ ++d +vi++L+k+rlK k l+n+f+ ci+el NP_001073922.2 350 LLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGSEDMDVISHLIKIRLKPKVLLNHFMLCIREL 430 79*****************************************************************************98 PP
Or compare NP_001073922.2 to CDD or PaperBLAST