Q6P4S8 has 2195 amino acids
Query: DUF3677 [M=81]
Accession: PF12432.12
Description: Protein of unknown function (DUF3677)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7e-39 118.4 1.9 2.3e-38 116.7 1.9 2.0 1 Q6P4S8
Domain annotation for each sequence (and alignments):
>> Q6P4S8
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 116.7 1.9 2.3e-38 2.3e-38 1 81 [] 352 432 .. 352 432 .. 0.99
Alignments for each domain:
== domain 1 score: 116.7 bits; conditional E-value: 2.3e-38
DUF3677 1 llklLsslcgipevrllvasrleiwlqnpKLvreaqelLlslcvncntssekdsevidaLvklrlKtkalinlftacikel 81
ll+lL+++cg++evrll+++rle+wlqnpKL+r+aq+lL+s+c+ncn++ ++d +vi++L+k+rlK k l+n+++ ci+el
Q6P4S8 352 LLRLLTATCGYKEVRLLAVQRLEMWLQNPKLTRPAQDLLMSVCMNCNSHGSEDMDVISHLIKIRLKPKVLLNHYMLCIREL 432
79*****************************************************************************98 PP
Or compare Q6P4S8 to CDD or PaperBLAST