WP_014513846.1 has 882 amino acids
Query: Cmr2_N [M=111] Accession: PF12469.12 Description: CRISPR-associated protein Cmr2, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-33 100.6 0.3 6.6e-33 99.4 0.3 1.7 1 WP_014513846.1 Domain annotation for each sequence (and alignments): >> WP_014513846.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.4 0.3 6.6e-33 6.6e-33 2 111 .] 190 315 .. 189 315 .. 0.91 Alignments for each domain: == domain 1 score: 99.4 bits; conditional E-value: 6.6e-33 Cmr2_N 2 vvvsigpVqefIaaaRktrDlWagSwllSylawkaieelveeyGpdvliyPslrgnplvdawlee.................klseelktallpn 79 +v++++ +qefI+ +Rk rDlWa+Swl S+l+wk iee++e+yGpdv ++P+l+ n+++ awl + l++++++ ++ + WP_014513846.1 190 AVLEFPSIQEFISISRKSRDLWASSWLPSALLWKSIEEFIEKYGPDVALRPELSLNHFFIAWLYNkvqnsksevkkyaekyaGLKDDPRISMMSE 284 5789************************************************************9777777777777666665566********* PP Cmr2_N 80 kfvlilpkekeaeelaeeiekalkeawkeiae 111 k++l+lp+ + +++++++++++ +awk iae WP_014513846.1 285 KVILLLPED-DTNKIKDRLRENFYKAWKSIAE 315 *******55.589****************986 PP
Or compare WP_014513846.1 to CDD or PaperBLAST