NP_001269718.1 has 243 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.5e-21 60.3 0.1 1.8e-20 59.2 0.1 1.5 1 NP_001269718.1
Domain annotation for each sequence (and alignments):
>> NP_001269718.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.2 0.1 1.8e-20 1.8e-20 27 71 .] 67 109 .. 57 109 .. 0.96
Alignments for each domain:
== domain 1 score: 59.2 bits; conditional E-value: 1.8e-20
GARIL_Rab2_bd 27 lklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekdq 71
l++vt++++yl+L++ d+pe++f++w+rlv++L+++ls+t+kd+
NP_001269718.1 67 LRTVTEKIYYLKLHP--DHPETVFHFWIRLVQILQKGLSITTKDP 109
9**************..**************************96 PP
Or compare NP_001269718.1 to CDD or PaperBLAST