Q8TC56 has 605 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-34 103.8 0.3 3.9e-34 103.0 0.3 1.4 1 Q8TC56
Domain annotation for each sequence (and alignments):
>> Q8TC56
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 103.0 0.3 3.9e-34 3.9e-34 1 70 [. 116 185 .. 116 186 .. 0.97
Alignments for each domain:
== domain 1 score: 103.0 bits; conditional E-value: 3.9e-34
GARIL_Rab2_bd 1 tleltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekd 70
tleltrllPlkfvk+s++d+ekq+l+lkl+tgR+fyl+L++s+d++e+lf +w++lv+lLr+p++++ ++
Q8TC56 116 TLELTRLLPLKFVKISIHDHEKQQLRLKLATGRTFYLQLCPSSDTREDLFCYWEKLVYLLRPPVESYCST 185
79***************************************************************99876 PP
Or compare Q8TC56 to CDD or PaperBLAST